PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018889-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 92aa    MW: 10606.2 Da    PI: 10.6255
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018889-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.4e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++q+G g+W+tI+   g+ R +k+c++rw +yl
  AHYPO_018889-RA 17 KGLWSPEEDERLRNYINQHGHGCWSTIPINAGLQRNGKSCRLRWINYL 64
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2551268IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-241367IPR009057Homeodomain-like
SMARTSM007171.2E-121666IPR001005SANT/Myb domain
PfamPF002495.6E-161764IPR001005SANT/Myb domain
SuperFamilySSF466893.8E-221991IPR009057Homeodomain-like
CDDcd001676.55E-112064No hitNo description
Gene3DG3DSA:1.10.10.601.0E-86891IPR009057Homeodomain-like
PROSITE profilePS512947.4076991IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGYKPLQESK PKIKHRKGLW SPEEDERLRN YINQHGHGCW STIPINAGLQ RNGKSCRLRW  60
INYLRPGLKR GTFSPQEEEK ILNLHSALGN K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667574.15e-48PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K47e-40LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D2UAY06e-47A0A0D2UAY0_G
STRINGPOPTR_0015s13190.11e-45(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.13e-41myb domain protein 45